Cathelicidins and LL-37: the body's own antimicrobial peptides
A plain-language record on cathelicidins — antibiotics the body makes for itself — and human LL-37: what it is, how it defends and heals, why vitamin D switches it on, and the peptide-stability frontier behind an AMP-therapeutics age. Compiled by Panacea Bio Chem.
- Peptide
- LL-37 — the sole human cathelicidin (cathelicidin antimicrobial peptide)
- Gene
- CAMP (cathelicidin antimicrobial peptide), chromosome 3p21.31; NCBI Gene 820
- Precursor
- hCAP18 — human cationic antimicrobial protein, 18 kDa (UniProt P49913)
- Sequence
- [LL-37, 37 aa] (37 residues)
- Length / charge
- 37 amino acids; net charge ≈ +6; amphipathic α-helix on membranes
- Class
- Cationic host-defence antimicrobial peptide (AMP); cathelin-domain family
- Made by
- Neutrophils (stored in granules); skin, gut, lung and other epithelia; macrophages
- Induced by
- Active vitamin D (calcitriol) via a vitamin-D response element in the CAMP promoter
Cathelicidins are antimicrobial peptides the body manufactures itself — short, positively charged chains that tear open microbial membranes and, at the same time, call in and tune the immune response. They belong to the innate immune system, the fast, inherited defence that acts within minutes, and every one of them is built from a shared cathelin domain plus a variable killing peptide. Humans carry a single cathelicidin gene, CAMP, whose precursor hCAP18 is cut to release LL-37 — 37 residues, named for its two opening leucines. LL-37 is broadly antimicrobial, strongly immunomodulatory, and a driver of wound healing; uniquely, it is switched on by vitamin D. This record walks from what cathelicidins are, through what LL-37 does and the old sunlight-and-tuberculosis story that turned out to run through it, to the open engineering problem of the antibiotic-resistance era: turning fragile peptides into stable, deliverable medicines.
1.What cathelicidins are
Cathelicidins1 are one of the two great families of antimicrobial peptides in vertebrates (the other being the defensins). An antimicrobial peptide is just what it sounds like: a short protein chain — usually a few dozen amino acids — that the body makes as a ready-to-use weapon against microbes. They are not learned, like antibodies; they are part of the innate immune system, the ancient, inherited defence that reacts within minutes rather than days. In one form or another, molecules like these are found across almost all of life, from insects and frogs to humans.
What makes a peptide a cathelicidin specifically is a structural signature. Each is made as a longer precursor with two parts: a conserved front half called the cathelin domain — named because it resembles cathelin, an inhibitor of the enzyme cathepsin L — and a variable back half that is the actual antimicrobial peptide. The cathelin domain acts like a safety catch, keeping the weapon inert while it is stored; only when an enzyme cuts the two apart is the active peptide set loose. That design lets a cell hold a membrane-disrupting molecule safely inside itself until the moment it is needed.
Different animals carry different cathelicidins — pigs have PR-39 and the protegrins, cattle and mice have their own versions. Humans, by contrast, have exactly one. Its gene is CAMP, and the peptide it ultimately yields is LL-37.
2.LL-37: the single human cathelicidin
The human cathelicidin gene, CAMP2, sits on chromosome 3 and codes for a precursor protein called hCAP18 — human cationic antimicrobial protein, about 18 kilodaltons. hCAP18 is the storage form: it is made and packed away, most famously in the granules of neutrophils (the first-responder white blood cells), but also by keratinocytes in skin, by the linings of the gut, lung and urinary tract, and by other immune cells.
When it is needed, an enzyme snips hCAP18 in two. In neutrophils the protease proteinase 3 does the cutting; in skin, serine proteases such as the kallikreins do it, sometimes trimming the peptide further into shorter variants. The active fragment released is LL-373. Its curious name is simply a description: it is 37 amino acids long and begins with two Leucine residues — L, L, 37.
Physically, LL-37 is a small, strongly positively charged (cationic) chain that is unstructured while floating free but folds into an amphipathic α-helix the instant it touches a membrane — a helix with all its water-loving residues on one face and its greasy residues on the other. That charge and that shape are the whole trick. Microbial membranes are studded with negatively charged lipids; the cationic peptide is drawn to them, inserts its greasy face, and rips the membrane open. Human cell membranes, being more neutral and cholesterol-rich on the outside, are far less inviting — which is how the peptide tells friend from foe.
3.What LL-37 does: kill, signal, heal
It is tempting to think of LL-37 as only an antibiotic, but its usefulness is that it does three jobs at once.
| Role | How it works | Why it matters |
|---|---|---|
| Direct antimicrobial | Cationic helix disrupts negatively charged microbial membranes | Broad reach — many bacteria, some fungi and enveloped viruses |
| Immunomodulation | Recruits neutrophils, monocytes and T-cells; neutralises bacterial endotoxin (LPS) | Marshals and calms the wider immune response |
| Wound healing | Promotes new blood-vessel growth and re-covering of the skin surface | Speeds repair; low levels track with chronic, non-healing wounds |
The direct killing is the membrane attack described above, and it is deliberately broad: because it targets a physical property shared by microbes rather than one precise molecule, a single peptide can act against very different organisms. The immune signalling is subtler and arguably more important. LL-37 is a chemoattractant — it acts as a flare that draws immune cells to the site — and it mops up lipopolysaccharide, the inflammatory endotoxin shed by Gram-negative bacteria, helping to prevent a dangerous over-reaction. And in a healing wound it encourages the growth of new blood vessels and the migration of skin cells back across the gap.
That power cuts both ways. When cathelicidin is too low, as in the skin condition atopic dermatitis, infections take hold more easily. When it is made in the wrong amounts or wrong forms, it turns on its host: aberrant processing of cathelicidin is implicated in rosacea, and in psoriasis LL-37 can bind a person's own DNA and trip the immune system into attacking healthy skin. A molecule this potent is only ever as good as the control around it — a theme worth holding onto.
4.The vitamin-D switch
Here is where cathelicidin becomes genuinely surprising. The control region of the CAMP gene contains a vitamin-D response element4 — a short stretch of DNA that the activated vitamin-D receptor can dock onto and switch the gene on. In practical terms, that means active vitamin D directly turns up production of LL-37.
The wiring is elegant. When an immune cell such as a macrophage senses a microbe through its pattern-recognition receptors, it responds by boosting both the vitamin-D receptor and the enzyme that converts stored vitamin D into its active form. If — and only if — there is enough vitamin D on hand, that activated vitamin D then flips the cathelicidin gene on, and the cell arms itself with its own peptide antibiotic. Sensing the threat and making the weapon are thus linked, with vitamin D as the required key.
This vitamin-D-to-cathelicidin link is specific to primates. The response element sits inside an Alu element — a piece of mobile DNA that inserted into the CAMP control region in a primate ancestor — so the tight coupling of vitamin D and antimicrobial defence is, in evolutionary terms, a relatively recent and human-relevant invention.
So does taking vitamin D actually raise your LL-37? The mechanism says it can; the human data say it depends where you start. In a small study of healthy adults, circulating hCAP18/LL-37 tracked vitamin-D status only in people whose levels were below about 32 ng/mL — above that, the link vanished8. And in patients with active tuberculosis, serum vitamin D and LL-37 concentrations did not correlate at all7. The honest summary: enough vitamin D is required for the switch to work, deficiency is where it bites hardest, and whether topping up beyond sufficiency adds protection remains an open research question.
5.Why it matters now: resistance and the AMP frontier
For most of the last century, a bacterial infection meant a course of antibiotics and little more thought. That era is closing. Antimicrobial resistance5 — bacteria evolving to shrug off the drugs that once killed them — is now among the largest threats in medicine, and the pipeline of genuinely new antibiotic classes has run thin. The MRSA in the photograph at the top of this record is one face of it.
Against that backdrop, host-defence peptides like LL-37 have drawn intense interest as a template for a new kind of antibiotic. Their appeal is mechanistic: because they attack the physical membrane rather than a single enzyme or receptor, microbes find it harder — though far from impossible — to evolve around them, and the same peptide can hit many organisms and even calm the accompanying inflammation. Several natural and engineered antimicrobial peptides have moved into clinical study, mostly as topical agents to begin with.
But the peptides carry a hard problem in their own chemistry, and it is the reason many promising candidates stall. As drugs, short peptides are fragile. They are chopped up quickly by the body's own proteases, they can lose activity in the salt and serum of the bloodstream, they may irritate or damage healthy cells at high doses, and they are demanding to manufacture, purify and — crucially — to keep intact in a vial long enough to reach a patient. The science of what these molecules do is, in many ways, ahead of the engineering of how to deliver them. That gap is the frontier.
6.Field note: the sunlight cure, explained a century late
Before antibiotics, the great killer was tuberculosis — "consumption" — and one of the few things that seemed to help was strange: sunlight. Physicians sent consumptive patients to high, sun-drenched Alpine sanatoria to rest on open-air balconies. In 1903 the Danish physician Niels Finsen won the Nobel Prize for treating lupus vulgaris — tuberculosis of the skin — with concentrated light. And for generations, children at risk of the disease were dosed with cod-liver oil. None of it had a mechanism; it was empirical, folk-medical, faintly mystical. It also, sometimes, worked.
The thread that ties those remedies together is vitamin D — made in skin by sunlight, and abundant in cod-liver oil. But why vitamin D should matter to a lung infection stayed a mystery for a hundred years. The answer came in 2006, when a team led by researchers at UCLA showed the missing step6. When a human macrophage detects Mycobacterium tuberculosis, it ramps up the vitamin-D machinery; the activated vitamin D then switches on cathelicidin; and the cathelicidin helps the macrophage kill the bacteria it has swallowed. Strikingly, blood serum low in vitamin D supported far less of this response — a laboratory echo of why the deficient and the sun-starved fared worse.
The old cure was real all along, and it ran straight through this peptide. Sunlight and cod-liver oil worked because they let the body make its own antibiotic — a lesson that a molecule's effect can be known and used for a century before its mechanism, and before anyone thinks to ask how to keep that fragile molecule intact.
7.The stability frontier — where Panacea Bio Chem works
Panacea Bio Chem designs, synthesises and formulates fragile biomolecules — custom peptides above all — and researches this exact sphere: the host-defence and antimicrobial-peptide space, and the last-mile problem the resistance era has thrown into relief. The company's interest is not clinical dosing, which belongs to medicine, but the engineering question that Section 5 named — how a molecule as potent and as delicate as a cathelicidin is carried from a synthesiser to the point of use with its structure, charge and activity intact.
Peptides like LL-37 are a textbook hard case. They are proteolytically fragile, sensitive to oxidation at exposed residues, prone to aggregation, and easily undone by heat, moisture or the wrong storage state. Keeping such a molecule true through synthesis, purification, drying and storage is a discipline in itself — and it is the sphere Panacea researches, through proprietary methods first built for peptides and biologics:
- The custom-synthesis craft itself — designed, made-to-spec peptides → — where purity and identity are engineered in from the first coupling rather than corrected later.
- Gentle water removal that dries a fragile peptide without cooking or collapsing it — Cryolapse™, freeze-drying the way nature would → — the step where many peptides are lost.
- Holding the dried peptide as a stable glass rather than a restless powder — TgShift™, raising the glass-transition ceiling → — which slows the molecular motion that ages a peptide in the vial.
- Isolating an oxidation-prone chain from the oxygen and trace metals that quietly degrade it — RedoxVault™, a vault against oxidation → — directly relevant to peptides with exposed, reactive residues.
The precise sequences, formulations, parameters and hardware that make these methods repeatable remain proprietary to Panacea Bio Chem, held by Bogdan Dicoias — the outline is here; the recipe stays behind the door.
8.Potential application fields
Where would careful peptide design and preservation — keeping a host-defence peptide intact and deliverable — hit hardest? A few directions where the unmet need is largest, offered as research inspiration rather than finished claims:
- Topical anti-infectives for resistant skin and wound infections — the setting where membrane-active peptides are furthest along and where a stable, ready-to-use formulation matters most against organisms like MRSA.
- Chronic and non-healing wounds — where LL-37's twin gifts, killing microbes and driving repair, line up exactly with the clinical problem, if the peptide can be delivered active and protected.
- Endotoxin-neutralising formulations — using the LPS-mopping property to blunt the inflammatory storm of severe Gram-negative infection, a job that demands a peptide kept precisely intact.
- Coatings and device surfaces — anchoring host-defence peptides onto catheters, implants and dressings to resist colonisation, where surface stability and shelf-life are everything.
- Fragile actives generally — the preservation problem is not cathelicidin-specific; it recurs across every peptide, protein and biologic the wider network studies that must survive the journey from synthesiser to point of use.
These are framed as research directions and open questions — inspiration for future work, not claims of completed products.
Frequently asked
What are cathelicidins?
A family of host-defence antimicrobial peptides the body makes itself, as part of the innate immune system. Each is built from a conserved cathelin domain plus a variable antimicrobial peptide, stored in white blood cells and made by surface tissues such as skin and gut. Humans have a single cathelicidin gene, CAMP.
What is LL-37?
The only cathelicidin peptide in humans. It is cut from a precursor, hCAP18 (from the CAMP gene), and is named because it is 37 amino acids long and begins with two leucines. LL-37 is a positively charged, amphipathic peptide that folds into a helix, disrupts microbial membranes, signals to immune cells and helps wounds heal. This is a research explainer; nothing here is medical advice.
How is vitamin D linked to cathelicidin?
The CAMP gene carries a vitamin-D response element, so active vitamin D switches cathelicidin production on. In immune cells, sensing a microbe raises the vitamin-D machinery, which then induces LL-37 only when enough vitamin D is present — a primate-specific link that helps explain why sunlight and cod-liver oil once helped against tuberculosis.
Does taking vitamin D raise LL-37 levels?
The mechanism is real — active vitamin D switches the CAMP gene on (Section 4). In people, the evidence is correlational and mixed: in 19 healthy adults, circulating hCAP18/LL-37 tracked vitamin-D status, but only below about 32 ng/mL (Dixon 2012); in 95 patients with active tuberculosis, serum vitamin D and LL-37 did not correlate (Yamshchikov 2010). Vitamin D appears to matter most when levels are low; whether supplements raise LL-37 enough to change infection outcomes is still an open question. Nothing here is medical advice.
Trending in the field
Recent developments in the field — refreshed 2026-09-09 by Panacea Bio Chem.
- Coordination chemistry and antimicrobial activity of LL-37, its C-terminal fragment, and a peptidomimetic analogue — PubMed, 2026 Sep 8
- Emerging antimicrobial peptides in gastrointestinal disorders: Dual role in immunity and therapy — PubMed, 2026 Sep 5
- Salivary cathelicidin LL-37 as a non-invasive biomarker for oral cancer detection — PubMed, 2026
- Plasma levels of antimicrobial peptide LL-37 as a biomarker of sleep quality in patients with obstructive sleep apnea: A clinical observational study — PubMed, 2026
References & further reading
- Cathelicidin — the host-defence peptide family. Wikipedia. Background: Antimicrobial peptides.
- CAMP (cathelicidin antimicrobial peptide) gene. NCBI Gene 820; Wikipedia.
- LL-37 — the human cathelicidin peptide (from hCAP18). PubMed.
- Vitamin D, the CAMP promoter and cathelicidin induction. PubMed.
- Antimicrobial resistance — overview. Wikipedia. Antimicrobial peptides as therapeutics: PubMed.
- Liu PT, et al. Toll-like receptor triggering of a vitamin-D-mediated human antimicrobial response. Science 2006. PubMed (PMID 16497887).
- Yamshchikov AV, et al. Vitamin D status and antimicrobial peptide cathelicidin (LL-37) concentrations in patients with active pulmonary tuberculosis. Am J Clin Nutr 2010. PubMed (PMID 20610636).
- Dixon BM, et al. Positive correlation between circulating cathelicidin antimicrobial peptide (hCAP18/LL-37) and 25-hydroxyvitamin D levels in healthy adults. BMC Res Notes 2012. PubMed (PMID 23095332).























